PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067895001
Common NameGSBRNA2T00067895001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 281aa    MW: 31236.1 Da    PI: 8.5973
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067895001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.1e-332377155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  GSBRNA2T00067895001 23 KPRLRWTADLHDRFVDAVAKLGGADKATPKSVLKLMGLKGLTLYHLKSHLQKYRL 77
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-322081IPR009057Homeodomain-like
PROSITE profilePS5129412.2852080IPR017930Myb domain
TIGRFAMsTIGR015576.4E-242378IPR006447Myb domain, plants
SuperFamilySSF466891.97E-162380IPR009057Homeodomain-like
PfamPF002491.6E-92576IPR001005SANT/Myb domain
PfamPF143794.1E-19128173IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MERVNLGGLG YENGGVMMTR DPKPRLRWTA DLHDRFVDAV AKLGGADKAT PKSVLKLMGL  60
KGLTLYHLKS HLQKYRLGQQ QAKKQNRTEQ NKENAGISYV HFDNCSQGGI SNESRFDNHL  120
RQSGNVPFAD TLRHQVDAQQ RFQEQLEVQK KLQMRMEAQG KYLLTLLEKA QKSMPCGGNG  180
AETDKGQFSD FNLALSGLVG NDHKSNKAGL ITNISHVNGD LTDNFRLCGE RDTGETEDAC  240
VKPESGFVHF DLNSKDGYDL LNSGKYGIEM KPNVIADRHQ *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937770.0AB493777.1 Arabidopsis thaliana At5g45580 mRNA for hypothetical protein, partial cds, clone: RAAt5g45580.
GenBankBT0120030.0BT012003.1 Arabidopsis thaliana At5g45580 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013680520.10.0PREDICTED: myb family transcription factor APL-like
RefseqXP_009101587.10.0PREDICTED: myb family transcription factor APL
TrEMBLA0A078HRP50.0A0A078HRP5_BRANA; BnaAnng05640D protein
STRINGBra025071.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124952530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-173G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]